Description

  • Product name

    Recombinant human MLH3 protein
  • Biological activity

    Specific activity: 0.766 pmol/min/µg

    Assay Conditions: Reaction was performed in 50 mM Tris pH 7.4, 1 mM DTT, 0.5 mM EDTA, 500 nM Ub-AMC, and various amount of ab198631 in a volume of 50 μL. Reaction was incubated at 37°C for 30 min and fluorescent signal was measured at excitation of 360 nm, and emission at 460 nm.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDYKDDDDKAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKT MHRYTLEMFRTCQFCPQFREIIHKALIDRNIQATLESQKKLNWCREVRKL VALKTNGDGNCLMHATSQYMWGVQDTDLVLRKALFSTLKETDTRNFKFRW QLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTPMARSGLQYNSLE EIHIFVLCNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPAQE CYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDRGRFEDLKVHFLT DPENEMKEKLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLV DDYFELVQHEYKKWQENSEQGRREGHAQNPMEPSVPQLSLMDVKCETPNC PFFMSVNTQPLCHECSERRQKNQNKLPKLNSKPGPEGLPGMALGASRGEA YEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMKCRSPGCPFTLNVQHN GFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCFKR TTAEASSSLSTSLPPSCHQRSKSDPSRLVRSPSPHSCHRAGNDAPAGCLS QAARTPGDRTGTSKCRKAGCVYFGTPENKGFCTLCFIEYRENKHFAAASG KVSPTASRFQNTIPCLGRECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRT EEQLRSSQRRDVPRTTQSTSRPKCARASCKNILACRSEELCMECQHPNQR MGPGAHRGEPAPEDPPKQRCRAPACDHFGNAKCNGYCNECFQFKQMYGHH HHHH
    • Predicted molecular weight

      91 kDa including tags
    • Amino acids

      2 to 790
    • Tags

      His tag C-Terminus , DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab198631 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.63% Tris HCl, 64% Sodium chloride, 0.017% Potassium chloride, 0.04% Tween, 0.05% DTT, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • DNA mismatch repair protein Mlh3
    • HNPCC
    • HNPCC 7
    • HNPCC7
    • MGC138372
    • Mismatch repair gene MLH 3
    • Mismatch repair gene MLH3
    • MLH 3
    • MLH3
    • MLH3_HUMAN
    • MutL homolog 3
    • MutL homolog 3 (E. coli)
    • MutL protein homolog 3
    • S240II117
    see all
  • Function

    Probably involved in the repair of mismatches in DNA.
  • Tissue specificity

    Ubiquitous.
  • Involvement in disease

    Defects in MLH3 are the cause of hereditary non-polyposis colorectal cancer type 7 (HNPCC7) [MIM:614385]. Mutations in more than one gene locus can be involved alone or in combination in the production of the HNPCC phenotype (also called Lynch syndrome). Most families with clinically recognized HNPCC have mutations in either MLH1 or MSH2 genes. HNPCC is an autosomal, dominantly inherited disease associated with marked increase in cancer susceptibility. It is characterized by a familial predisposition to early onset colorectal carcinoma (CRC) and extra-colonic cancers of the gastrointestinal, urological and female reproductive tracts. HNPCC is reported to be the most common form of inherited colorectal cancer in the Western world, and accounts for 15% of all colon cancers. Cancers in HNPCC originate within benign neoplastic polyps termed adenomas. Clinically, HNPCC is often divided into two subgroups. Type I: hereditary predisposition to colorectal cancer, a young age of onset, and carcinoma observed in the proximal colon. Type II: patients have an increased risk for cancers in certain tissues such as the uterus, ovary, breast, stomach, small intestine, skin, and larynx in addition to the colon. Diagnosis of classical HNPCC is based on the Amsterdam criteria: 3 or more relatives affected by colorectal cancer, one a first degree relative of the other two; 2 or more generation affected; 1 or more colorectal cancers presenting before 50 years of age; exclusion of hereditary polyposis syndromes. The term 'suspected HNPCC' or 'incomplete HNPCC' can be used to describe families who do not or only partially fulfill the Amsterdam criteria, but in whom a genetic basis for colon cancer is strongly suspected.
    Defects in MLH3 are a cause of colorectal cancer (CRC) [MIM:114500].
  • Sequence similarities

    Belongs to the DNA mismatch repair mutL/hexB family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • Specific activity of ab198631.

  • 4-20% SDS-PAGE analysis of ab198631 with Coomassie staining

    Lane 1: 3 µg ab198631
    Lane 2: Protein marker

References

ab198631 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198631.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up