Recombinant Human MLLT11 protein (ab161219)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIG QATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFELDLL
    • Amino acids
      1 to 90
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161219 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AF1Q
    • AF1Q_HUMAN
    • ALL1 fused gene from chromosome 1q
    • MLLT 11
    • MLLT11
    • Myeloid/lymphoid or mixed lineage leukemia (trithorax homolog, Drosophila) translocated to 11
    • Protein AF1q
    • RP11 316M1.10
    see all
  • Tissue specificity
    Highly expressed in thymus and all leukemic cell lines.
  • Involvement in disease
    A chromosomal aberration involving MLLT11 is found in acute leukemias. Translocation t(1;11)(q21;q23) with KMT2A/MLL1.
  • Sequence similarities
    Belongs to the MLLT11 family.
  • Information by UniProt

Images

  • ab161219 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161219 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161219.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up