Description

  • Product name

    Recombinant Human MLLT11 protein (Tagged)
    See all MLLT11 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab199573 was refolded using a unique temperature shift inclusion body refolding technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGEFRDPVSSQYSSFLFWRMPIPELD LSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFN FWRAPIASIHSFELDLL
    • Predicted molecular weight

      13 kDa including tags
    • Amino acids

      2 to 90
    • Additional sequence information

      Full lenght protein without starter Methionine, constructed with a small T7-His-TEV cleavage site Tag (29 amino acids) fusion at the N-terminal.

Specifications

Our Abpromise guarantee covers the use of ab199573 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, Sucrose and DTT.

General Info

  • Alternative names

    • AF1Q
    • AF1Q_HUMAN
    • ALL1 fused gene from chromosome 1q
    • MLLT 11
    • MLLT11
    • Myeloid/lymphoid or mixed lineage leukemia (trithorax homolog, Drosophila) translocated to 11
    • Protein AF1q
    • RP11 316M1.10
    see all
  • Tissue specificity

    Highly expressed in thymus and all leukemic cell lines.
  • Involvement in disease

    A chromosomal aberration involving MLLT11 is found in acute leukemias. Translocation t(1;11)(q21;q23) with KMT2A/MLL1.
  • Sequence similarities

    Belongs to the MLLT11 family.
  • Information by UniProt

References

ab199573 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab199573.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up