Overview

  • Product name

    Recombinant Human MLYCD/MCD protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MRGFGPGLTARRLLPLRLPPRPPGPRLASGQAAGALERAMDELLRRAVPP TPAYELREKTPAPAEGQCADFVSFYGGLAETAQRAELLGRLARGFGVDHG QVAEQSAGVLHLRQQQREAAVLLQAEDRLRYALVPRYRGLFHHISKLDGG VRFLVQLRADLLEAQALKLVEGPDVREMNGVLKGMLSEWFSSGFLNLERV TWHSPCEVLQKISEAEAVHPVKNWMDMKRRVGPYRRCYFFSHCSTPGEPL VVLHVALTGDISSNIQAIVKEHPPSETEEKNKITAAIFYSISLTQQGLQG VELGTFLIKRVVKELQREFPHLGVFSSLSPIPGFTKWLLGLLNSQTKEHG RNELFTDSECKEISEITGGPINETLKLLLSSSEWVQSEKLVRALQTPLMR LCAWYLYGEKHRGYALNPVANFHLQNGAVLWRINWMADVSLRGITGSCGL MANYRYFLEETGPNSTSYLGSKIIKASEQVLSLVAQFQKNSKL
    • Amino acids

      1 to 493
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161633 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously labeled as MLYCD.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DCMC_HUMAN
    • hMCD
    • Malonyl CoA decarboxylase
    • Malonyl CoA decarboxylase mitochondrial
    • Malonyl coenzyme A decarboxylase
    • Malonyl-CoA decarboxylase
    • MCD
    • MGC59795
    • mitochondrial
    • Mlycd
    see all
  • Function

    Catalyzes the conversion of malonyl-CoA to acetyl-CoA. In the fatty acid biosynthesis MCD selectively removes malonyl-CoA and thus assures that methyl-malonyl-CoA is the only chain elongating substrate for fatty acid synthase and that fatty acids with multiple methyl side chains are produced. In peroxisomes it may be involved in degrading intraperoxisomal malonyl-CoA, which is generated by the peroxisomal beta-oxidation of odd chain-length dicarboxylic fatty acids.
  • Pathway

    Metabolic intermediate biosynthesis; acetyl-CoA biosynthesis; acetyl-CoA from malonyl-CoA: step 1/1.
  • Involvement in disease

    Malonyl-CoA decarboxylase deficiency (MLYCD deficiency) [MIM:248360]: Autosomal recessive disease characterized by abdominal pain, chronic constipation, episodic vomiting, metabolic acidosis and malonic aciduria. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Cellular localization

    Mitochondrion. Cytoplasm. Peroxisome.
  • Information by UniProt

Images

  • ab161633 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161633 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161633.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up