Description

  • Product name

    Recombinant Human MMP10 protein (denatured)
    See all MMP10 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSFSSFPGMPKWRKTHLTYRIVNYTPDLP RDAVDSAIEKALKVWEEVTPLTFSRLYEGEADIMISFAVKEHGDFYSFDG PGHSLAHAYPPGPGLYGDIHFDDDEKWTEDASGTNLFLVAAHELGHSLGL FHSANTEALMYPLYNSFTELAQFRLSQDDVNGIQSLYGPPPASTEEPLVP TKSVPSGSEMPAKCDPALSFDAISTLRGEYLFFKDRYFWRRSHWNPEPEF HLISAFWPSLPSYLDAAYEVNSRDTVFIFKGNEFWAIRGNEVQAGYPRGI HTLGFPPTIRKIDAAVSDKEKKKTYFFAADKYWRFDENSQSMEQGFPRLI ADDFPGVEPKVDAVLQAFGFFYFFSGSSQFEFDPNARMVTHILKSNSWLH C
    • Predicted molecular weight

      45 kDa including tags
    • Amino acids

      99 to 476
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_002416. Mature protein without signal peptide and propeptide.

Specifications

Our Abpromise guarantee covers the use of ab177631 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names

    • Matrix metallopeptidase 10 (stromelysin 2)
    • Matrix metalloprotease 10
    • Matrix metalloproteinase 10
    • Matrix metalloproteinase 10 (stromelysin 2)
    • Matrix metalloproteinase-10
    • MMP 10
    • MMP-10
    • Mmp10
    • MMP10_HUMAN
    • SL 2
    • SL-2
    • SL2
    • STMY 2
    • STMY2
    • Stromelysin 2
    • Stromelysin II
    • Stromelysin-2
    • Stromelysin2
    • StromelysinII
    • Transin 2
    • Transin-2
    • Transin2
    see all
  • Function

    Can degrade fibronectin, gelatins of type I, III, IV, and V; weakly collagens III, IV, and V. Activates procollagenase.
  • Sequence similarities

    Belongs to the peptidase M10A family.
    Contains 4 hemopexin-like domains.
  • Domain

    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab177631 (3 µg).

References

This product has been referenced in:

  • Dang Q  et al. Simple and sensitive electrogenerated chemiluminescence peptide-based biosensor for detection of matrix metalloproteinase 2 released from living cells. Anal Bioanal Chem N/A:N/A (2016). Read more (PubMed: 26939670) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177631.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up