Description

  • Product name

    Recombinant Human MMP14 protein (His tag)
    See all MMP14 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    Purified by using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/mg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADLALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAA MQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGL KWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYI REGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDS AEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTE NFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPN ICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPAS INTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDA ALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSF MGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEG TEEETEVIIIEVDEEGGGAVSHHHHHH
    • Predicted molecular weight

      60 kDa including tags
    • Amino acids

      21 to 538
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab219226 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names

    • Matrix metallopeptidase 14 (membrane inserted)
    • Matrix metalloproteinase 14
    • Matrix metalloproteinase-14
    • Membrane type 1 matrix metalloproteinase
    • Membrane type 1 metalloprotease
    • Membrane type matrix metalloproteinase 1
    • Membrane-type matrix metalloproteinase 1
    • Membrane-type-1 matrix metalloproteinase
    • MMP 14
    • MMP X1
    • MMP-14
    • MMP-X1
    • Mmp14
    • MMP14_HUMAN
    • MMPX1
    • MT MMP 1
    • MT-MMP 1
    • MT1 MMP
    • MT1-MMP
    • MT1MMP
    • MTMMP 1
    • MTMMP1
    see all
  • Function

    Seems to specifically activate progelatinase A. May thus trigger invasion by tumor cells by activating progelatinase A on the tumor cell surface. May be involved in actin cytoskeleton reorganization by cleaving PTK7.
  • Tissue specificity

    Expressed in stromal cells of colon, breast, and head and neck. Expressed in lung tumors.
  • Sequence similarities

    Belongs to the peptidase M10A family.
    Contains 4 hemopexin-like domains.
  • Domain

    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Post-translational
    modifications

    The precursor is cleaved by a furin endopeptidase.
  • Cellular localization

    Membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • 15% SDS-PAGE (3μg). ab219226 migrates at 35-70kDa under reducing conditions

References

ab219226 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219226.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up