Description

  • Product name

    Recombinant human MMP2 protein
    See all MMP2 proteins and peptides
  • Biological activity

    Specific Activity: 511 pmole/min/µg. 

    Activation: This is a proform enzyme and requires activation prior to testing activity. Dilute the enzyme to 100 ng/ml in a solution containing 50 mM HEPES, pH 7.4, 10 mM CaCl2, 0.05% Brij-35, and 1 mM APMA (amino-phenyl mercuric acetate). Incubate at 37ºC for 2 hours.
    Assay conditions: Reaction mixture with 10 μM 390 MMP substrate 1. Incubate for 30 minutes at room temperature. Fluorescence intensity is measured at exc328/em393.

  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQK FFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRII GYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHG DGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNAD GEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEAL FTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKY GFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRS DGKMWCAT TANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTY TKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDG IAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAP QEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKN KKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGG HSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGCHHHHHHHHHH
    • Predicted molecular weight

      72 kDa including tags
    • Amino acids

      30 to 660
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NM_004530.

Specifications

Our Abpromise guarantee covers the use of ab198429 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Preservative: 1.36% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 72 kDa gelatinase
    • 72kD type IV collagenase
    • CLG 4
    • CLG 4A
    • CLG4
    • CLG4A
    • Collagenase Type 4 alpha
    • Collagenase type IV A
    • Gelatinase A
    • Gelatinase alpha
    • Gelatinase neutrophil
    • Matrix metallopeptidase 2 gelatinase A 72kDa gelatinase 72kDa type IV collagenase
    • Matrix Metalloproteinase 2
    • Matrix metalloproteinase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase)
    • Matrix metalloproteinase II
    • Matrix metalloproteinase-2
    • MMP 2
    • MMP II
    • MMP-2
    • MMP2
    • MMP2_HUMAN
    • MONA
    • Neutrophil gelatinase
    • PEX
    • TBE 1
    • TBE-1
    see all
  • Function

    Ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading extracellular matrix proteins, can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. Also cleaves KISS at a Gly-
    -Leu bond. Appears to have a role in myocardial cell death pathways. Contributes to myocardial oxidative stress by regulating the activity of GSK3beta. Cleaves GSK3beta in vitro.
    PEX, the C-terminal non-catalytic fragment of MMP2, posseses anti-angiogenic and anti-tumor properties and inhibits cell migration and cell adhesion to FGF2 and vitronectin. Ligand for integrinv/beta3 on the surface of blood vessels.
  • Tissue specificity

    Produced by normal skin fibroblasts. PEX is expressed in a number of tumors including gliomas, breast and prostate.
  • Involvement in disease

    Defects in MMP2 are the cause of Torg-Winchester syndrome (TWS) [MIM:259600]; also known as multicentric osteolysis nodulosis and arthropathy (MONA). TWS is an autosomal recessive osteolysis syndrome. It is severe with generalized osteolysis and osteopenia. Subcutaneous nodules are usually absent. Torg-Winchester syndrome has been associated with a number of additional features including coarse face, corneal opacities, patches of thickened, hyperpigmented skin, hypertrichosis and gum hypertrophy. However, these features are not always present and have occasionally been observed in other osteolysis syndromes.
  • Sequence similarities

    Belongs to the peptidase M10A family.
    Contains 3 fibronectin type-II domains.
    Contains 4 hemopexin-like domains.
  • Domain

    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Post-translational
    modifications

    Phosphorylation on multiple sites modulates enzymatic activity. Phosphorylated by PKC in vitro.
    The propeptide is processed by MMP14 (MT-MMP1) and MMP16 (MT-MMP3). Autocatalytic cleavage in the C-terminal produces the anti-angiogenic peptide, PEX. This processing appears to be facilitated by binding integrinv/beta3.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix. Membrane. Nucleus. Colocalizes with integrin alphaV/beta3 at the membrane surface in angiogenic blood vessels and melanomas. Found in mitochondria, along microfibrils, and in nuclei of cardiomyocytes.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE Coomassie staining

    Lane 1: ab198429 (2.5µg)

    Lane 2: Protein Marker

  • Specific activity of ab198429.

References

ab198429 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198429.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up