Overview

  • Product name
    Recombinant Human MMP21 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TRYGDPIQILTGWPGIPTHNIDAFVHIWTWKRDERYFFQGNQYWRYDSDK DQALTEDEQGKSYPKLISEGFPGIPSPLDTAFYDRRQKLIYFFKESLVFA FDVNRNRV
    • Amino acids
      374 to 481
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165147 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Matrix metalloproteinase 21
    • MIFR
    • MMP 21
  • Relevance
    This protein is a member of the matrix metalloproteinase (MMP) family. MMP21 was first described as an MMP in Xenopus (XMMP), expressed in early embryo development. Later, species orthologs were reported in the Newt Cynops, and in rat, mouse and human. A literature alias was initiated by the deposit of sequences for MMP21/22, which were later renamed MMP23, the cysteine Array MMP (CAMMP). The mouse sequence seems also to be expressed early in embryo development, especially in the brain, and the human sequence has been reported in tumors. MMP21 contains the canonical MMP elements of cysteine switch (PRCGVPD) and HExGHxxxxxH catalytic zinc site, without a transmembrane sequence. The Xenopus and Cynops sequences contain a potential furin like cleavage site (RR/KKR), shortly after the cysteine switch, but the rat, mouse and human furin sites may not be functional. The hinge region is much shorter in MMP21 than in other MMPs, and the carboxyterminal half has some homology to vitronectin. Little is known about MMP21 function, expression or distribution. The relative low homology with other MMPs suggests a different distribution, and the regulatory elements known suggest quite different promotion than “classical” MMPs. The Xenopus and Cynops sequences have two inserts relative to the human and murine sequences, one in the propeptide domain, and one right after the cysteine switch. Interestingly, the pI for the human and murine proteins is quite basic, 9.334, 9.801 and 9.294 respectively for human, rat and mouse, while the Xenopus and Cynops predicted pI are 7.674 and 7.416. The basic pI and vitronectin homology suggest ECM localization. The 569 amino acid human zymogen has a predicted mass of 65.01 kD, the mouse and rat sequences at 65.45 and 61.07 kD, and the Xenopus and Cynops both about 70 kD, without posttranslational modifications.
  • Cellular localization
    Secreted

Images

  • ab165147 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165147 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165147.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up