Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      YPLDGAARGEDTSMNLVQKYLENYYDLEKDVKQFVRRKDSGPVVKKIREM QKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYR IVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVRE HGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAA HEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPP DSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRK SLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNE VRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNS MEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTH TLKSNSWLNCVDHHHHHH
    • Molecular weight

      52 kDa including tags
    • Amino acids

      18 to 477
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151945 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    ab151945 has purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. 0.2 µM filtered.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.05% Brij, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • CHDS6
    • Matrix metalloproteinase 3
    • Matrix metalloproteinase-3
    • MGC126102
    • MGC126103
    • MGC126104
    • MMP 3
    • MMP-3
    • MMP3
    • MMP3_HUMAN
    • Proteoglycanase
    • SL-1
    • SL1
    • STMY
    • STMY1
    • STR1
    • Stromelysin 1
    • Stromelysin-1
    • Transin 1
    • Transin-1
    see all
  • Function

    Can degrade fibronectin, laminin, gelatins of type I, III, IV, and V; collagens III, IV, X, and IX, and cartilage proteoglycans. Activates procollagenase.
  • Sequence similarities

    Belongs to the peptidase M10A family.
    Contains 4 hemopexin-like domains.
  • Domain

    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

References

ab151945 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151945.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up