Description

  • Product name

    Recombinant Human MMP3 protein (Tagged)
    See all MMP3 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab190394 was refolded using a unique temperature shift inclusion body refolding technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGGEFYPLDGAARGEDTSMNLVQKYL ENYYDLKKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLDSDTLEVMR KPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKAL KVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPG PGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYP LYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPA NCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPS GVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKI DAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKID AVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC
    • Predicted molecular weight

      56 kDa including tags
    • Amino acids

      18 to 477
    • Additional sequence information

      Full length chain not including signal peptide (NP_002413.1). Constructed with a small T7-His-TEV cleavage site Tag (29 amino acids) fusion at the N-terminal.

Specifications

Our Abpromise guarantee covers the use of ab190394 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, EDTA, KCl, arginine, DTT and glycerol.

General Info

  • Alternative names

    • CHDS6
    • Matrix metalloproteinase 3
    • Matrix metalloproteinase 3 preproprotein
    • Matrix metalloproteinase-3
    • MGC126102
    • MGC126103
    • MGC126104
    • MMP 3
    • MMP-3
    • MMP3
    • MMP3_HUMAN
    • Proteoglycanase
    • SL-1
    • SL1
    • STMY
    • STMY1
    • STR1
    • Stromelisin 1
    • Stromelysin 1
    • Stromelysin 1 progelatinase
    • Stromelysin-1
    • Transin 1
    • Transin-1
    see all
  • Function

    Can degrade fibronectin, laminin, gelatins of type I, III, IV, and V; collagens III, IV, X, and IX, and cartilage proteoglycans. Activates procollagenase.
  • Sequence similarities

    Belongs to the peptidase M10A family.
    Contains 4 hemopexin-like domains.
  • Domain

    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

References

ab190394 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190394.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up