Description

  • Product name

    Recombinant Human MMP7 protein
    See all MMP7 proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETK NANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPN SPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWG TADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTD GSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDD IKGIQKLYGKRSNSRKK
    • Amino acids

      1 to 267
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158904 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Matrilysin
    • Matrin
    • Matrix Metalloproteinase 7
    • Matrix metalloproteinase-7
    • MMP 7
    • MMP-7
    • MMP7
    • MMP7_HUMAN
    • MPSL1
    • PUMP 1
    • Pump 1 protease
    • Pump-1 protease
    • PUMP1
    • Uterine matrilysin
    • Uterine metalloproteinase
    see all
  • Function

    Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase.
  • Sequence similarities

    Belongs to the peptidase M10A family.
  • Domain

    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • ab158904 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158904 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158904.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up