Description

  • Product name

    Recombinant Human MMP8 protein (denatured)
    See all MMP8 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSLTPGNPKWERTNLTYRIRNYTPQLSEA EVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPN GILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAH SSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYGLSSNPIQPTGPSTPK PCDPSLTFDAITTLRGEILFFKDRYFWRRHPQLQRVEMNFISLFWPSLPT GIQAAYEDFDRDLIFLFKGNQYWALSGYDILQGYPKDISNYGFPSSVQAI DAAVFYRSKTYFFVNDQFWRYDNQRQFMEPGYPKSISGAFPGIESKVDAV FQQEHFFHVFSGPRYYAFDLIAQRVTRVARGNKWLNCRYG
    • Predicted molecular weight

      44 kDa including tags
    • Amino acids

      101 to 467
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Full length mature protein. NP_002415.
  • Description

    Recombinant Human MMP8 protein

Specifications

Our Abpromise guarantee covers the use of ab177636 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris-HCl buffer, 2.4% Urea, 10% Glycerol

General Info

  • Alternative names

    • CLG 1
    • CLG1
    • Collagenase 1
    • Collagenase 1 neutrophil
    • HNC
    • Matrix metallopeptidase 8 (neutrophil collagenase)
    • Matrix metalloprotease 8
    • Matrix metalloproteinase-8
    • MMP 8
    • MMP-8
    • Mmp8
    • MMP8_HUMAN
    • Neutrophil collagenase
    • PMNL CL
    • PMNL collagenase
    • PMNL-CL
    • PMNLCL
    see all
  • Function

    Can degrade fibrillar type I, II, and III collagens.
  • Tissue specificity

    Neutrophils.
  • Sequence similarities

    Belongs to the peptidase M10A family.
    Contains 4 hemopexin-like domains.
  • Domain

    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Cellular localization

    Cytoplasmic granule. Secreted > extracellular space > extracellular matrix. Stored in intracellular granules.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab177636 (3µg).

References

ab177636 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177636.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up