Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      APRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGP ALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHH NITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQ FGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVP TRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFG FCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTAN YDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDG RLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALM YPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCP TGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVN IFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDS VFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRS GRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYRE KAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPEDHHHHHHHHHH
    • Molecular weight
      78 kDa including tags
    • Amino acids
      20 to 707
    • Modifications
      mutated Q279 R
    • Tags
      His tag C-Terminus
    • Additional sequence information
      This product is the full length protein without the propeptide. Genbank Accession: NM_004994.

Specifications

Our Abpromise guarantee covers the use of ab198459 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity: ≥ 2500 pmole/min/µg
    Activation: This is a proform enzyme and requires activation prior to testing activity. Dilute the enzyme to 100 ng/ml in a solution containing 50 mM HEPES, pH 7.4, 10 mM CaCl2, 0.05% Brij-35, and 1 mM APMA (amino-phenyl mercuric acetate). Incubate at 37ºC for 2 hours.
    Assay conditions: Reaction mixture with 10 μM MMP substrate. Incubate for 30 minutes at room temperature. Fluorescence intensity is measured at Ex328/Em393.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Preservative: 1.36% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • 82 kDa matrix metalloproteinase-9
    • 92 kDa gelatinase
    • 92 kDa type IV collagenase
    • CLG 4B
    • CLG4B
    • Collagenase Type 4 beta
    • Collagenase type IV 92 KD
    • EC 3.4.24.35
    • Gelatinase 92 KD
    • Gelatinase B
    • Gelatinase beta
    • GelatinaseB
    • GELB
    • Macrophage gelatinase
    • MANDP2
    • Matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
    • Matrix Metalloproteinase 9
    • MMP 9
    • MMP-9
    • MMP9
    • MMP9_HUMAN
    • Type V collagenase
    see all
  • Function
    May play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-
    -Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide.
  • Tissue specificity
    Produced by normal alveolar macrophages and granulocytes.
  • Involvement in disease
    Intervertebral disc disease
    Metaphyseal anadysplasia 2
  • Sequence similarities
    Belongs to the peptidase M10A family.
    Contains 3 fibronectin type-II domains.
    Contains 4 hemopexin repeats.
  • Domain
    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Post-translational
    modifications
    Processing of the precursor yields different active forms of 64, 67 and 82 kDa. Sequentially processing by MMP3 yields the 82 kDa matrix metalloproteinase-9.
    N- and O-glycosylated.
  • Cellular localization
    Secreted, extracellular space, extracellular matrix.
  • Information by UniProt

Images

  • Specific activity of activated ab198459.

  • 4-20% SDS-PAGE analysis of ab198459 with Coomassie staining.

    Lane 1: 6.3 µg ab198459
    Lane 2: Protein marker

References

ab198459 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198459.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up