Description

  • Product name

    Recombinant Human MMS19 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRELLELSCCHSCPFSSTAAAKCFAGLLNKHPAGQQLDEFLQLAVDKVEA GLGSGPCRSQAFTLLLWVTKALVLRYHPLSSCLTARLMGLLSDPELGPAA ADGFSLLMSDCTDVLTRAGHAEVRIMFRQRFFTDNVPALVQGFHAAPPDV KPNYLKGLSHVLNRLPKPVLLPELPTLLSLLLEALSCPDCVVQLSTLSCL QPLLLEAPQVMSLHVDTLVTKFLNLSSSPSMAVRIAALQCMHALTRLPTP VLLPYKPQVIRALAKSLDDKKRLVRKEAVSARGEWFLLGSPGS
    • Amino acids

      1 to 293
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163801 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • hMMS19
    • homolog of yeast MMS19
    • MET18
    • MET18 homolog
    • MET18MMS19 nucleotide excision repair homolog (S. cerevisiae)
    • mms19
    • MMS19 nucleotide excision repair protein homolog
    • MMS19 nucleotide excision repair, S. cerevisiae, homolog of
    • MMS19-like (MET18 homolog, S. cerevisiae)
    • MMS19-like protein
    • MMS19_HUMAN
    • MMS19L
    see all
  • Function

    May play a role in nucleotide excision repair (NER) and RNA polymerase II (POL II) transcription by interacting with ERCC2/XPD and ERCC3/XPB helicases, both subunits of NER-transcription factor TFIIH. May also function as a transcriptional coactivator of estrogen receptor (ER). May be involved in regulation of ER activity by bridging TFIIH with ER or may facilitate TFIIH-mediated phosphorylation of ER in specific promoters and cell types. As part of the mitotic spindle-associated MMXD complex it plays a role in chromosome segregation.
  • Tissue specificity

    Ubiquitously expressed with higher expression in testis.
  • Sequence similarities

    Belongs to the MET18/MMS19 family.
    Contains 7 HEAT repeats.
  • Cellular localization

    Nucleus. Cytoplasm > cytoskeleton > spindle.
  • Information by UniProt

Images

  • ab163801 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163801 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163801.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up