Description

  • Product name

    Recombinant Human MMS21 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPGRSSSNSGSTGFISFSGVESALSSLKNFQACINSGMDTASSVALDLVE SQTEVSSEYSMDKAMVEFATLDRQLNHYVKAVQSTINHVKEERPEKIPDL KLLVEKKFLALQSKNSDADFQNNEKFVQFKQQLKELKKQCGLQADREADG TEGVDEDIIVTQSQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIES RQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKKRHRHSE
    • Predicted molecular weight

      54 kDa including tags
    • Amino acids

      1 to 247

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132298 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.

    Previously labelled as NSE2.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C8orf36
    • E3 SUMO-protein ligase NSE2
    • hMMS21
    • hNSE2
    • methyl methanesulfonate sensitivity gene 21
    • MMS21
    • MMS21 homolog
    • non-SMC element 2
    • Non-SMC element 2 homolog
    • Non-structural maintenance of chromosomes element 2 homolog
    • NSE2
    • NSE2_HUMAN
    • Nsmce2
    see all
  • Function

    E3 SUMO-protein ligase component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. Acts as a E3 ligase mediating SUMO attachment to various proteins such as SMC6L1 and TRAX, and maybe the cohesin components RAD21 and STAG2. SUMO protein-ligase activity is required for the prevention of DNA damage-induced apoptosis by facilitating DNA repair.
  • Pathway

    Protein modification; protein sumoylation.
  • Sequence similarities

    Belongs to the NSE2 family.
    Contains 1 SP-RING-type zinc finger.
  • Post-translational
    modifications

    Sumoylated, possibly via autosumoylation.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132298.

References

ab132298 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132298.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up