Overview

  • Product name

    Recombinant Human MNAT1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGDDQGCPRCKTTKYRNPSLKLMVNV CGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFEDPTVDKEVEIR KKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLDNTKKKMEIY QKENKDVIQKNKLKLTREQEELEEALEVERQENEQRRLFIQKEEQLQQIL KRKNKQAFLDELESSDLPVALLLAQHKDRSTQLEMQLEKPKPVKPVTFST GIKMGQHISLAPIHKLEEALYEYQPLQIETYGPHVPELEMLGRLGYLNHV RAASPQDLAGGYTSSLACHRALQDAFSGLFWQPS
    • Molecular weight

      39 kDa including tags
    • Amino acids

      2 to 309
    • Tags

      His-T7 tag N-Terminus
    • Additional sequence information

      Constructed with codon optimization technology and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies.

Specifications

Our Abpromise guarantee covers the use of ab204195 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab204195 was refolded using unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, arginine, DTT and glycerol. Sterile-filtered

General Info

  • Alternative names

    • MNAT 1
    • CAP35
    • CDK activating kinase assembly factor MAT1
    • CDK-activating kinase assembly factor MAT1
    • CDK7/cyclin H assembly factor
    • CDK7/cyclin-H assembly factor
    • Cyclin G1 interacting protein
    • Cyclin-G1-interacting protein
    • MAT1
    • MAT1_HUMAN
    • Menage a trois
    • Menage a trois 1 (CAK assembly factor)
    • Menage a trois homolog 1, cyclin H assembly factor (Xenopus laevis)
    • MNAT CDK activating kinase assembly factor 1
    • Mnat1
    • p35
    • p36
    • RING finger protein 66
    • RING finger protein MAT1
    • RNF66
    • TFB3
    see all
  • Function

    Stabilizes the cyclin H-CDK7 complex to form a functional CDK-activating kinase (CAK) enzymatic complex. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminus domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Involved in cell cycle control and in RNA transcription by RNA polymerase II.
  • Tissue specificity

    Highest levels in colon and testis. Moderate levels are present thymus, prostate, ovary, and small intestine. The lowest levels are found in spleen and leukocytes.
  • Sequence similarities

    Contains 1 RING-type zinc finger.
    Contains 1 UIM (ubiquitin-interacting motif) repeat.
  • Cellular localization

    Nucleus.
  • Information by UniProt

References

ab204195 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204195.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up