Description

  • Product name

    Recombinant Human MND1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSKKKGLSAEEKRTRMMEIFSETKDVFQLKDLEKIAPKEKGITAMSVKEV LQSLVDDGMVDCERIGTSNYYWAFPSKALHARKHKLEVLESQLSEGSQKH ASLQKSIEKAKIGRCETEERTRLAKELSSLRDQREQLKAEVEKYKDCDPQ VVEEIRQANKVAKEAANRWTDNIFAIKSWAKRKFGFEENKIDRTFGIPED FDYID
    • Amino acids

      1 to 205
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164483 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as GAJ

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2610034E18Rik
    • AI591601
    • GAJ protein
    • Homolog of yeast MND1
    • Meiotic nuclear division 1, S. cerevisiae. homolog of
    • Meiotic nuclear division protein 1 homolog
    • Meiotic nuclear divisions 1 homolog
    • Meiotic nuclear divisions 1 homolog (S. cerevisiae)
    • MGC134110
    • MND1
    • RGD1309007
    see all
  • Relevance

    The product of the MND1 gene associates with HOP2 to form a stable heterodimeric complex that binds DNA and stimulates the recombinase activity of RAD51 and DMC1 (Chi et al., 2007 [PubMed 17639080]). Both the MND1 and HOP2 genes are indispensable for meiotic recombination.
  • Cellular localization

    Nuclear

Images

  • ab164483 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164483 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164483.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up