Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      GRCGSDCGWDRGEACPACQNMLFESIQEGKYEFPDKDWAHISCAAKDLIS KLLVRDAKQRLSAAQVLQHPWVQGCAPENTLPTPMVLQRWDSHFLLPPHP CRIHVRPGGLVRTVTVNE
    • Molecular weight

      39 kDa including tags
    • Amino acids

      297 to 414

Specifications

Our Abpromise guarantee covers the use of ab152438 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • G protein coupled receptor kinase 7
    • GPRK7
    • MAP kinase interacting serine threonine kinase
    • MAP kinase interacting serine threonine kinase 2
    • MAP kinase interacting serine threonine protein kinase 2
    • MAP kinase signal integrating kinase 2
    • MAP kinase signal-integrating kinase 2
    • MAP kinase-interacting serine/threonine-protein kinase 2
    • MAPK interacting kinase 2
    • MAPK signal integrating kinase 2
    • Mitogen activated protein kinase interacting serine threonine kinase 2
    • Mknk2
    • MKNK2_HUMAN
    • Mnk2
    • Putative map kinase interacting kinase
    see all
  • Function

    May play a role in the response to environmental stress and cytokines. Appears to regulate transcription by phosphorylating EIF4E, thus increasing the affinity of this protein for the 7-methylguanosine-containing mRNA cap.
  • Tissue specificity

    Ubiquitously expressed in all tissues examined. Isoform 2 is expressed at higher levels in the ovary than is isoform 1.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Dual phosphorylation of Thr-244 and Thr-249 activates the kinase. Phosphorylation of Thr-379 activates the kinase.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152438 stained with Coomassie Blue.

References

ab152438 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152438.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up