Description

  • Product name

    Recombinant Human MnSOD protein (His tag)
  • Purity

    > 90 % SDS-PAGE.
    Affinity Purified
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH HSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSI FWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWL GFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDY LKAIWNVINWENVTERYMACKK
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      1 to 222
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab245919 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.70
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.08% DTT, 10% Glycerol

General Info

  • Alternative names

    • IPOB
    • Manganese superoxide dismutase
    • mitochondrial
    • SOD2
    • SODM_HUMAN
    • Superoxide dismutase [Mn]
    • Superoxide dismutase [Mn] mitochondrial precursor
    • Superoxide dismutase 2 mitochondrial
    see all
  • Function

    Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.
  • Involvement in disease

    Genetic variation in SOD2 is associated with susceptibility to microvascular complications of diabetes type 6 (MVCD6) [MIM:612634]. These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis.
  • Sequence similarities

    Belongs to the iron/manganese superoxide dismutase family.
  • Post-translational
    modifications

    Nitrated under oxidative stress. Nitration coupled with oxidation inhibits the catalytic activity.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt

Images

  • SDS-PAGE analysis of Human MnSOD protein (His tag) (ab245919)

References

ab245919 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab245919.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up