Overview

  • Product name
    Recombinant Human MOBP protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSG CFYQKKEEDWICCACQKTRLKRKIRPTPKKK
    • Amino acids
      1 to 81
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158912 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC87379
    • Myelin associated oligodendrocyte basic protein
  • Relevance
    MOBP (Myelin-associated oligodendrocytic basic protein) is abundantly expressed specifically in oligodendrocytes and is the third most abundant protein in CNS myelin. MOBP is present in the major dense line of CNS myelin suggesting a role in the compaction or stabilization of myelin.
  • Cellular localization
    Cytoplasmic

Images

  • ab158912 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158912 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158912.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up