Description

  • Product name

    Recombinant Human MOCS2 protein
  • Purity

    > 90 % SDS-PAGE.
    ab134527 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMSSLEISSSCFSLE TKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVI SPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKW PVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPI WKKEIYEESSTWKGNKECFWASNS
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      1 to 188
    • Tags

      His tag N-Terminus , DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134527 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 50% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • MCBPE
    • MOCO1
    • MOCO1 B
    • MOCO1B
    • MOCS 2
    • MOCS2
    • MOCS2A
    • MOCS2B
    • Molybdenum cofactor biosynthesis protein E
    • Molybdenum cofactor synthesis 2
    • Molybdenum cofactor synthesis protein 2 large subunit
    • molybdenum cofactor synthesis protein 2 small subunit
    • molybdenum cofactor synthesis protein 2A
    • Molybdenum cofactor synthesis protein 2B
    • Molybdopterin synthase
    • Molybdopterin synthase large subunit
    • molybdopterin-synthase small subunit
    • MPT synthase
    • MPTS
    • OTTHUMP00000122459
    • sulfur carrier protein MOCS2A
    see all
  • Relevance

    The large (MOCS2B) and small (MOCS2A) subunits of molybdopterin synthase are both encoded from the MOCS2 gene by overlapping open reading frames. MOCS2B is the catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin. It acts by mediating the incorporation of 2 sulfur atoms from thiocarboxylated MOCS2A into precursor Z to generate a dithiolene group.
  • Cellular localization

    Cytoplasmic

Images

  • 15% SDS-PAGE analysis of 3 µg ab134527.

References

ab134527 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134527.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up