Description

  • Product name

    Recombinant Human MOGAT3 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGVATTLQPPTTSKTLQKQHLEAVGAYQYVLTFLFMGPFFSLLVFVLLFT SLWPFSVFYLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKT AELPPDRNYVLGAHPHGIMCTGFLCNFSTESNGFSQLFPGLRPWLAVLAG LFYLPVYRDYIMSFGLCPVSRQSLDFILSQPQLGQAVVIMVGGAHEALYS VPGEHCLTLQKRKGFVRLALRHGASLVPVYSFGENDIFRLKAFATGSWQH WCQLTFKKLMGFSPCIFWGRGLFSATSWGLLPFAVPITTVVGRPIPVPQR LHPTEEEVNHYHALYMTALEQLFEEHKESCGVPASTCLTFI
    • Amino acids

      1 to 341
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166322 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2 acylglycerol O acyltransferase 3
    • 2-acylglycerol O-acyltransferase 3
    • Acyl CoA:monoacylglycerol acyltransferase 3
    • Acyl coenzyme A:monoacylglycerol acyltransferase 3
    • Acyl-CoA:monoacylglycerol acyltransferase 3
    • DC 7
    • DC7
    • DGAT2L7
    • Diacylglycerol acyltransferase 2 like protein 7
    • Diacylglycerol acyltransferase 2-like protein 7
    • Diacylglycerol O acyltransferase candidate 7
    • Diacylglycerol O-acyltransferase candidate 7
    • hDC 7
    • hDC7
    • MGAT 3
    • MGAT3
    • MGC119203
    • MGC119204
    • MOGAT 3
    • MOGAT3
    • MOGT3_HUMAN
    • Monoacylglycerol O acyltransferase 3
    • Monoacylglycerol O-acyltransferase 3
    see all
  • Function

    Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. Also able to catalyze the terminal step in triacylglycerol synthesis by using diacylglycerol and fatty acyl-CoA as substrates. Has a preference toward palmitoyl-CoA and oleoyl-CoA. May be involved in absorption of dietary fat in the small intestine by catalyzing the resynthesis of triacylglycerol in enterocytes.
  • Tissue specificity

    Selectively expressed in the digestive system. Highly expressed in the ileum, and at lower level in jejunum, duodenum, colon, cecum and the rectum. Not expressed in the stomach and the esophagus and trachea. Expressed at very low level in liver.
  • Pathway

    Glycerolipid metabolism; triacylglycerol biosynthesis.
  • Sequence similarities

    Belongs to the diacylglycerol acyltransferase family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab166322 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166322 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166322.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up