Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGVATTLQPPTTSKTLQKQHLEAVGAYQYVLTFLFMGPFFSLLVFVLLFT SLWPFSVFYLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKT AELPPDRNYVLGAHPHGIMCTGFLCNFSTESNGFSQLFPGLRPWLAVLAG LFYLPVYRDYIMSFGLCPVSRQSLDFILSQPQLGQAVVIMVGGAHEALYS VPGEHCLTLQKRKGFVRLALRHGASLVPVYSFGENDIFRLKAFATGSWQH WCQLTFKKLMGFSPCIFWGRGLFSATSWGLLPFAVPITTVVGRPIPVPQR LHPTEEEVNHYHALYMTALEQLFEEHKESCGVPASTCLTFI
    • Amino acids
      1 to 341
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166322 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2 acylglycerol O acyltransferase 3
    • 2-acylglycerol O-acyltransferase 3
    • Acyl CoA:monoacylglycerol acyltransferase 3
    • Acyl coenzyme A:monoacylglycerol acyltransferase 3
    • Acyl-CoA:monoacylglycerol acyltransferase 3
    • DC 7
    • DC7
    • DGAT2L7
    • Diacylglycerol acyltransferase 2 like protein 7
    • Diacylglycerol acyltransferase 2-like protein 7
    • Diacylglycerol O acyltransferase candidate 7
    • Diacylglycerol O-acyltransferase candidate 7
    • hDC 7
    • hDC7
    • MGAT 3
    • MGAT3
    • MGC119203
    • MGC119204
    • MOGAT 3
    • MOGAT3
    • MOGT3_HUMAN
    • Monoacylglycerol O acyltransferase 3
    • Monoacylglycerol O-acyltransferase 3
    see all
  • Function
    Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. Also able to catalyze the terminal step in triacylglycerol synthesis by using diacylglycerol and fatty acyl-CoA as substrates. Has a preference toward palmitoyl-CoA and oleoyl-CoA. May be involved in absorption of dietary fat in the small intestine by catalyzing the resynthesis of triacylglycerol in enterocytes.
  • Tissue specificity
    Selectively expressed in the digestive system. Highly expressed in the ileum, and at lower level in jejunum, duodenum, colon, cecum and the rectum. Not expressed in the stomach and the esophagus and trachea. Expressed at very low level in liver.
  • Pathway
    Glycerolipid metabolism; triacylglycerol biosynthesis.
  • Sequence similarities
    Belongs to the diacylglycerol acyltransferase family.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab166322 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166322 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166322.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up