Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGG RTYTIRNEHVDYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQY VKGKTYPFRGAFPPVWNPIAYLDYNNLWRTIDNMGKEIPTDAPWEAQHAD KWDKMTMKELIDKICWTKTARRFAYLFVNINVTSEPHEVSALWFLWYVKQ CGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKLNHPVTHVDQS SDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPM GAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIM GFILARKADRLAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEE QYSGGCYTAYFPPGIMTQYGRVIRQPVGRIFFAGTETATKWSGYMEGAVE AGERAAREVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVSG LLKIIGFSTSVTALGFVLYKYKLLPRS
    • Molecular weight

      86 kDa including tags
    • Amino acids

      1 to 527

Specifications

Our Abpromise guarantee covers the use of ab132985 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

    Previously labelled as Monoamine Oxidase A. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Amine oxidase [flavin containing] A
    • Amine oxidase [flavin-containing] A
    • AOFA
    • AOFA_HUMAN
    • EC 1.4.3.4
    • MAO A
    • MAO-A
    • maoA
    • Monoamine oxidase A
    • Monoamine oxidase type A
    see all
  • Function

    Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.
  • Tissue specificity

    Heart, liver, duodenum, blood vessels and kidney.
  • Involvement in disease

    Defects in MAOA are the cause of Brunner syndrome (BRUNS) [MIM:300615]. Brunner syndrome is a form of X-linked non-dysmorphic mild mental retardation. Male patients are affected by a syndrome of borderline mental retardation and exhibit abnormal behavior, including disturbed regulation of impulsive aggression. Obligate female carriers have normal intelligence and behavior.
  • Sequence similarities

    Belongs to the flavin monoamine oxidase family.
  • Cellular localization

    Mitochondrion outer membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132985 stained with Coomassie Blue.

References

ab132985 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132985.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up