Recombinant Human Monoamine Oxidase A/MAO-A protein (denatured) (ab203543)

Description

  • Product name

    Recombinant Human Monoamine Oxidase A/MAO-A protein (denatured)
    See all Monoamine Oxidase A/MAO-A proteins and peptides
  • Purity

    > 80 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMENQEKASIAGHMFDVVVIGGGISGLS AAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHVDYVDVGGAYVGPTQNRI LRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIAYLDYNNL WRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLF VNINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVS ERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTL TAKIHFRPELPAERNQLIQRLPMGAVIKCMMYYKEAFWKKKDYCGCMIIE DEDAPISITLDDTKPDGSLPAIMGFILARKADRLAKLHKEIRKKKICELY AKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYGRVIRQPV GRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPE SKDVPAVEITHTFWERNLPS
    • Predicted molecular weight

      59 kDa including tags
    • Amino acids

      1 to 497
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Cytoplasmic domain (NP_000231).

Specifications

Our Abpromise guarantee covers the use of ab203543 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as Monoamine Oxidase A. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • Amine oxidase [flavin containing] A
    • Amine oxidase [flavin-containing] A
    • AOFA
    • AOFA_HUMAN
    • EC 1.4.3.4
    • MAO A
    • MAO-A
    • maoA
    • Monoamine oxidase A
    • Monoamine oxidase type A
    see all
  • Function

    Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.
  • Tissue specificity

    Heart, liver, duodenum, blood vessels and kidney.
  • Involvement in disease

    Defects in MAOA are the cause of Brunner syndrome (BRUNS) [MIM:300615]. Brunner syndrome is a form of X-linked non-dysmorphic mild mental retardation. Male patients are affected by a syndrome of borderline mental retardation and exhibit abnormal behavior, including disturbed regulation of impulsive aggression. Obligate female carriers have normal intelligence and behavior.
  • Sequence similarities

    Belongs to the flavin monoamine oxidase family.
  • Cellular localization

    Mitochondrion outer membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab203543 (3 μg).

References

ab203543 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203543.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up