Description

  • Product name

    Recombinant Human Monocarboxylic acid transporter 1 protein
    See all Monocarboxylic acid transporter 1 proteins and peptides
  • Biological activity

    Protein corresponds to variant rs1049434 with D-E substitution at position 490.
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPPAVGGPVGYTPPDGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGI FHATTSEVSWISSIMLAVMYGGGPISSILVNKYGSRIVMIVGGCLSGCGL IAASFCNTVQQLYVCIGVIGGLGLAFNLNPALTMIGKYFYKRRPLANGLA MAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNCCVAGALMRPIGP KPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTIN QFLDLTLFTHRGFLLYLSGNVIMFFGLFAPLVFLSSYGKSQHYSSEKSAF LLSILAFVDMVARPSMGLVANTKPIRPRIQYFFAASVVANGVCHMLAPLS TTYVGFCVYAGFFGFAFGWLSSVLFETLMDLVGPQRFSSAVGLVTIVECC PVLLGPPLLGRLNDMYGDYKYTYWACGVVLIISGIYLFIGMGINYRLLAK EQKANEQKKESKEEETSIDVAGKPNEVTKAAESPDQKDTEGGPKEEESPV
    • Predicted molecular weight

      80 kDa
    • Amino acids

      1 to 500

Specifications

Our Abpromise guarantee covers the use of ab152689 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
    Best use within three months from the date of receipt of this protein.Protein corresponds to variant rs1049434 with D-E substitution at position 490.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ36745
    • HHF7
    • MCT
    • MCT 1
    • MGC44475
    • Monocarboxylate transporter
    • Monocarboxylate transporter 1
    • Monocarboxylate transporter isoform 1
    • Monocarboxylic acid transporter 1
    • MOT1_HUMAN
    • Slc16a1
    • SLC16A1 protein
    • Solute carrier family 16 (monocarboxylic acid transporters) member 1
    • Solute carrier family 16 member 1
    • Solute carrier family 16 member 1 (monocarboxylic acid transporter 1)
    see all
  • Function

    Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.
  • Tissue specificity

    Widely expressed in normal and in cancer cells.
  • Involvement in disease

    Symptomatic deficiency in lactate transport
    Familial hyperinsulinemic hypoglycemia 7
  • Sequence similarities

    Belongs to the major facilitator superfamily. Monocarboxylate porter (TC 2.A.1.13) family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab152689 stained with Coomassie Blue.

References

ab152689 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152689.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up