Description

  • Product name

    Recombinant Human MORC3 protein (Tagged)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQI WIDKTVINDHICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLY GNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAF NKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWN LRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPESDYS LRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDVY
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      1 to 290
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-SUMO tag.

Specifications

Our Abpromise guarantee covers the use of ab225648 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • KIAA0136
    • Microrchidia 3
    • MORC family CW type zinc finger 3
    • MORC family CW type zinc finger protein 3
    • MORC family CW-type zinc finger protein 3
    • MORC3
    • MORC3_HUMAN
    • Nuclear matrix protein 2
    • Nuclear matrix protein NXP2
    • NXP2
    • ZCW5
    • ZCWCC3
    • Zinc finger CW type coiled coil domain 3
    • Zinc finger CW type coiled coil domain protein 3
    • Zinc finger CW type with coiled coil domain 3
    • Zinc finger CW-type coiled-coil domain protein 3
    see all
  • Function

    Nuclear factor which forms MORC3-NBs (nuclear bodies) via an ATP-dependent mechanism (PubMed:20501696). Sumoylated MORC3-NBs can also associate with PML-NBs (PubMed:20501696). Recruits TP53 and SP100 to PML-NBs, thus regulating TP53 activity (PubMed:17332504). Binds RNA in vitro (PubMed:11927593). May be required for influenza A transcription during viral infection (PubMed:26202233).
  • Tissue specificity

    Expressed in heart, placenta, skeletal muscle, brain, pancreas, lung, liver, but not kidney.
  • Sequence similarities

    Contains 1 CW-type zinc finger.
  • Post-translational
    modifications

    Sumoylation is involved in interaction with PML and localization to PML nuclear bodies.
  • Cellular localization

    Nucleus, nucleoplasm. Nucleus matrix. Nucleus, PML body. Also found in PML-independent nuclear bodies. Localization to nuclear bodies is ATP-dependent.
  • Information by UniProt

Images

  • Discontinuous SDS-PAGE (Tris-Glycine gel) (reduced) with 5% enrichment gel and 15% separation gel.

References

ab225648 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225648.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up