Description

  • Product name

    Recombinant Human Motilin protein
  • Purity

    > 95 % SDS-PAGE.
    Determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      FVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENE MIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAKVDHHHHHH
    • Predicted molecular weight

      13 kDa
    • Amino acids

      26 to 115
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab194032 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Reconstitute for long term storage.

    pH: 7.4
    Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

    Lyophilized from a 0.2 µM filtered solution.

  • Reconstitution
    Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 25 months.

General Info

  • Alternative names

    • MAP
    • MGC138519
    • MLN
    • MOTI_HUMAN
    • Motilin-associated peptide
    • Promotilin
    see all
  • Function

    Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
  • Sequence similarities

    Belongs to the motilin family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab194032 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194032.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up