Recombinant Human MOV10L1/Champ protein (ab162743)

Overview

  • Product name

    Recombinant Human MOV10L1/Champ protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      FLIGRYLEVNVISGEESLIAAREPFSWKKLKSSQALTSAKTTVVVTAQKR NSRRQLPSFLPQYPIPDRLRKCVEQKIDILTFQPLLAELLNMSNYKEKFS TLLWLEEIYA
    • Amino acids

      436 to 545
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162743 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cardiac helicase activated by MEF2 protein
    • Cardiac specific RNA helicase
    • CHAMP
    • Csm
    • M10L1_HUMAN
    • Moloney leukemia virus 10 like protein 1
    • Moloney leukemia virus 10-like protein 1
    • MOV10 like 1
    • MOV10 like protein 1
    • MOV10-like protein 1
    • MOV10L1
    • Mov10l1, Moloney leukemia virus 10 like 1, homolog (mouse)
    • Putative helicase Mov10l1
    see all
  • Function

    Putative RNA helicase. Isoform 1 may play a role in male germ cell development.
  • Tissue specificity

    Isoform 1 is specifically expressed in testis.
  • Sequence similarities

    Belongs to the DNA2/NAM7 helicase family. SDE3 subfamily.
  • Information by UniProt

Images

  • ab162743 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162743 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162743.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up