Description

  • Product name

    Recombinant Human MPG/AAG protein
  • Purity

    > 90 % SDS-PAGE.
    ab109955 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MVTPALQMKKPKQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSD AAQAPCPRERCLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPAVPLAR AFLGQVLVRRLPNGTELRGRIVETEAYLGPEDEAAHSRGGRQTPRNRGMF MKPGTLYVYIIYGMYFCMNISSQGDGACVLLRALEPLEGLETMRQLRSTL RKGTASRVLKDRELCSGPSKLCQALAINKSFDQRDLAQDEAVWLERGPLE PSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQALE HHHHHH
    • Predicted molecular weight

      34 kDa including tags
    • Amino acids

      1 to 298
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109955 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

    Western blot

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as MPG

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 30% Glycerol, 0.32% Tris HCl, 1% DTT, 1.17% Sodium chloride, 0.03% EDTA

General Info

  • Alternative names

    • 3 alkyladenine DNA glycosylase
    • 3-alkyladenine DNA glycosylase
    • 3-methyladenine DNA glycosidase
    • 3MG_HUMAN
    • AAG
    • ADPG
    • Alkyladenine DNA glycosylase
    • anpg
    • APNG
    • CRA36.1
    • DNA 3 methyladenine glycosylase
    • DNA-3-methyladenine glycosylase
    • MDG
    • Mid1
    • Mpg
    • N methylpurine DNA glycosirase
    • N methylpurine DNA glycosylase
    • N-methylpurine-DNA glycosylase
    • PIG11
    • PIG16
    • Proliferation inducing protein 11
    • Proliferation inducing protein 16
    see all
  • Function

    Hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions.
  • Sequence similarities

    Belongs to the DNA glycosylase MPG family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab109955 (3µg)
  • Anti-MPG/AAG antibody (ab55461) at 1 µg/ml + Recombinant Human MPG/AAG protein (ab109955) at 0.1 µg

    Secondary
    Goat Anti-Mouse IgG H&L (HRP) preadsorbed (ab97040) at 1/5000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Exposure time: 10 seconds

References

ab109955 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-4 of 4 Abreviews or Q&A

Question
Answer

Thank you for contacting us.

I am sorry that this antibody did not perform as stated on the datasheet, I have asked our Finance department to issue a credit note for you. The credit note may be used in one of the following ways:

(1) Redeemed against the original invoice if this hasn't already been paid.
(2) Held on the account for use against a future order.
(3) A full refund can be offered where no other invoices are outstanding.

Please contact your Finance department to confirm how you would like the credit note to be used and ensure it is not redeemed without your knowledge.

To specifically receive a refund please ask your Finance department to contact our Finance department at creditcontrol@abcam.com or by telephone using the information at the “Contact Us” link in the top right corner of our website.

The credit note ID is for your reference only, please refer to the credit note ID in any correspondence with our accounting department. We will send you the completed credit note by email or postal mail with the actual credit note number which will start with the letters CGB.

I hope this experience will not prevent you from purchasing other products from us in the future. Our Scientific Support team is always at your service should you require further expert advice

Read More

Question
Answer

Sure I can set up a credit for the customer.

If you could, please forward me the customer's email address so I can associate it with the credit note.

Thanks!

Read More

Question
Answer

Thank you for the additional information.

I have initiated the replaplacement request. Please let me know if you have any further questions.

Read More

Question

Inquiry: DETAILS Antibody code:Ab37983
Batch number: GR44142-1 Antibody storage conditions (temperature/reconstitution etc) Aliquots stored at -20C Description of the problem (high background, wrong band size, more bands, no band etc.) Very high background and very low signal for extracts (positive control - ab109955 – nice signal but still high background) Sample (Species/Cell extract/Nuclear extract/Purified protein/Recombinant protein etc.) Whole cell extract from purified PBMCs Sample preparation (Buffer/Protease inhibitors/Heating sample etc.) The frozen lymphocytes were thawed at 30°C, after which their protein content was extracted with 220mM KCl for 30 minutes on ice. Cell debris were removed by centrifugation at 13,200 rpm for 15 minutes at 4°C. Glycerol was added to the protein extract to a final concentration of 10%, and the extract was frozen in liquid nitrogen. Amount of protein loaded Up to 40ug Electrophoresis/Gel conditions (Reducing or Non-reducing gel, % of the gel etc.) Reducing, 12 and 15 % gel Transfer and blocking conditions (Buffer/time period, Blocking agent etc.) Transfer – Tris / Glycine with MeOH Blocking – TBS-T with 5% milk (I tried also BSA – results were worse) Primary Antibody (Manufacturer/Species/Diluent/Dilution/Incubation time, Wash step) Ab37983 – Goat polyclonal 1:400 / 1:1000 ON – 4C / 1hr – RT Wash: 3x 10min / 5x 5min Secondary Antibody (Manufacturer/Species/Diluent/Dilution/Incubation time, Wash step) Donkey anti goat of two different manufactures (Sigma / Jackson) diluted up to 1:100,000 1hr at RT Wash: 3x 10min / 5x 5min Detection method (ECL, ECLPlus etc.) ECL (also ECL plus that gave even higher background) Positive and negative controls used (please specify) Commercial protein – ab109955
OPTIMIZATION ATTEMPTS (PROBLEM SOLVING) How many times have you tried the Western? I tried a lot of times with extracts from different extractions (from different blood donors), different Ab dilutions, washes, blocking, 2 different second antibodies with a lot of dilution. The background is very very high so I can’t see a signal in extracts only in commercial protein. Have you run a "No Primary" control? No Do you obtain the same results every time? e.g. are the background bands always in the same place? Problem all the time – of course gets worse with lower 2nd Ab dilution etc…. – never got better! What steps have you altered? Extracts source and preparation, Ab dilutions (1st and 2nd), washes, blocking Additional Notes In data shit a nice signal appears – can you give me more details or if you have any suggestions, I’d appreciate it.

Read More
Answer

Thank you for submitting your completed questionnaire. You have done a great job of troubleshooting and it appears the problem in this case is with the antibody.

If you have received this vial of ab37983 within the past 6 months or so I would be happy to offer a replacement.

In your reply, please include the purchase order number or Abcam order reference number associated with this purchase so I can process your request.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up