Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      SVRTAWEKNKSVSYEQCKPVSVTPQGNDFEYTAKIRTLAETERFFDELTK EKDQIEAALSRMPSPGGRITLQTRLNQEALEDRLERINRELGSVRMTLKK FHVLRTSANL
    • Amino acids

      922 to 1031
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160869 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • M phase phosphoprotein 9
    • M-phase phosphoprotein 9
    • Mphosph9
    • MPP 9
    • MPP9
    • MPP9_HUMAN
    see all
  • Post-translational
    modifications

    Phosphorylated in M (mitotic) phase.
  • Cellular localization

    Cytoplasm > cytoskeleton > centrosome > centriole. Golgi apparatus membrane. Localizes to the distal and proximal end of centriole pairs in duplicated centrosomes. In ciliated cells, localizes to the distal and proximal end of daughter centriole and proximal of the mother centriole but not in the distal end of the mother centriole.
  • Information by UniProt

Images

  • ab160869 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160869 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160869.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up