Overview

  • Product name

    Recombinant Human MPP1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTN GSPAPGSPAQVKGQEVRKVRLIQFEKVTEEPMGITLKLNEKQSCTVARIL HGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKAMKETKGMISLKVIP NQQSRLPALQMFMRAQFDYDPKKDNLIPCKEAGLKFATGDIIQIINKDDS NWWQGRVEGSSKESAGLIPSPELQEWRVASMAQSAPSEAPSCSPFGKKKK YKDKYLAKHSSIFDQLDVVSYEEVVRLPAFKRKTLVLIGASGVGRSHIKN ALLSQNPEKFVYPVPYTTRPPRKSEEDGKEYHFISTEEMTRNISANEFLE FGSYQGNMFGTKFETVHQIHKQNKIAILDIEPQTLKIVRTAELSPFIVFI APTDQGTQTEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAF DQACSSPQWVPVSWVY
    • Molecular weight

      77 kDa including tags
    • Amino acids

      1 to 466

Specifications

Our Abpromise guarantee covers the use of ab132579 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 55 kDa erythrocyte membrane protein
    • AAG 12
    • AAG12
    • Aging associated gene 12
    • DXS552
    • DXS552E
    • EM55_HUMAN
    • EMP 55
    • EMP55
    • Erythrocyte membrane protein p55
    • Membrane protein
    • Membrane protein palmitoylated 1
    • Membrane protein palmitoylated 1 55kDa
    • Membrane protein, palmitoylated 1, 55kDa
    • Migration related gene 1
    • MPP 1
    • MPP1
    • MRG 1
    • MRG1
    • OTTHUMP00000026054
    • OTTHUMP00000196176
    • p55
    • palmitoylated 1
    • Palmitoylated erythrocyte membrane protein
    • Palmitoylated membrane protein 1
    • PEMP
    see all
  • Function

    Essential regulator of neutrophil polarity. Regulates neutrophil polarization by regulating AKT1 phosphorylation through a mechanism that is independent of PIK3CG activity.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the MAGUK family.
    Contains 1 guanylate kinase-like domain.
    Contains 1 PDZ (DHR) domain.
    Contains 1 SH3 domain.
  • Post-translational
    modifications

    Extensively palmitoylated.
  • Cellular localization

    Membrane. Cell projection > stereocilium. Colocalizes with WHRN at stereocilium tip during hair cell development (By similarity). Colocalizes with MPP5 in the retina, at the outer limiting membrane (OLM). Colocalizes with WHRN in the retina, at the outer limiting membrane (OLM), outer plexifirm layer (OPL), basal bodies and at the connecting cilium (CC). Colocalizes with NF2 in non-myelin-forming Schwann cells.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132579 stained with Coomassie Blue.

References

ab132579 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132579.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up