Overview

  • Product name
    Recombinant Human MPP10 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NVKKNSDEVKSSFEKRQEKMNEKIASLEKELLEKKPWQLQGEVTAQKRPE NSLLEETLHFDHAVRMAPVITEETTLQLEDIIKQRIRDQAWDDVVRKEKP KEDAYEYKKR
    • Amino acids
      348 to 457
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160870 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as MPHOSPH10. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • M phase phosphoprotein 10
    • M phase phosphoprotein 10 (U3 small nucleolar ribonucleoprotein)
    • MPHOSPH 10
    • Mphosph10
    • MPP 10
    • MPP 10P
    • MPP10
    • MPP10_HUMAN
    • MPP10P
    • U3 small nucleolar ribonucleoprotein protein mpp10
    see all
  • Function
    Component of the 60-80S U3 small nucleolar ribonucleoprotein (U3 snoRNP). Required for the early cleavages during pre-18S ribosomal RNA processing.
  • Sequence similarities
    Belongs to the MPP10 family.
  • Post-translational
    modifications
    Phosphorylated in M (mitotic) phase.
  • Cellular localization
    Nucleus > nucleolus. Chromosome. Fibrillar region of the nucleolus. After dissolution of the nucleolus in early M phase becomes associated with chromosomes through metaphase and anaphase. In telophase localized to small cellular prenucleolar bodies that not always contain fibrillarin. The reassociation with nucleolus is preceeded by the arrival of fibrillarin.
  • Information by UniProt

Images

  • ab160870 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160870 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160870.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up