Description

  • Product name

    Recombinant Human MPP5/Pals1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTTSHMNGHVTEESDSEVKNVDLASPEEHQKHREMAVDCPGDLGTRMMPI RRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGID NPMFDTEEGIVLESPHYAVKILEIEDLFSSLKHIQHTLVDSQSQEDISLL LQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNAQDLAQEVQTVLKPV HHKEGQELTALLNTPHIQALLLAHDKVAEQEMQLEPITDERVYESIGQYG GETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDE VLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHV KAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDN QPLAGLVPGKSFQQQREAMKQTIEEDKEPEKSGKLWCAKKNKKKRKKVLY NANKNDDYDNEEILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLM NKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADIAAGKFIEHGE FEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPP SQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDK AYQELLRLINKLDTEPQWVPSTWLR
    • Predicted molecular weight

      104 kDa including tags
    • Amino acids

      1 to 675

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132220 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.

     This product was previously labelled as MPP5

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ12615
    • MAGUK p55 subfamily member 5
    • Membrane protein palmitoylated 5
    • MPP 5
    • MPP5
    • MPP5_HUMAN
    • PALS 1
    • PALS1
    • Protein associated with Lin-7
    • Stardust
    • Stardust (Drosophila)
    see all
  • Function

    May play a role in tight junctions biogenesis and in the establishment of cell polarity in epithelial cells. May modulate SC6A1/GAT1-mediated GABA uptake by stabilizing the transporter. Required for localization of EZR to the apical membrane of parietal cells and may play a role in the dynamic remodeling of the apical cytoskeleton.
  • Tissue specificity

    Expressed in the retina (at protein level).
  • Sequence similarities

    Belongs to the MAGUK family.
    Contains 1 guanylate kinase-like domain.
    Contains 2 L27 domains.
    Contains 1 PDZ (DHR) domain.
    Contains 1 SH3 domain.
  • Domain

    The L27 domain 1 functions in targeting to the tight junctions by binding to INADL.
    The PDZ domain binds to the C-terminus of SC6A1.
  • Cellular localization

    Cell membrane. Endomembrane system. Cell junction > tight junction. Localized to the tight junctions of epithelial cells and a subset of intracellular vesicles. In the retina, detected at the outer limiting membrane (OLM), apical to the adherens junction (AJ), where it colocalizes with CRB1. Colocalizes with MPP1 in the retina at the outer limiting membrane (OLM). Localized to the Purkinje cell body and axon.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132220 stained with Coomassie Blue.

References

ab132220 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132220.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up