Overview

  • Product name

    Recombinant Human MPP8 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MTLVMLAAAGGQDDLLRLLITKGAKVNGRQKNGTTALIHAAEKNFLTTVA ILLEAGAFVNVQQSNGETALMKACKRGNSDIVRLVIECGADCNILSKHQN SALHFAKQSNNVLVYDLLKNHLETLSRVAEETIKDYFEARLALLEPVFPI ACHRLCEGPDFSTDFNYKPPQNIPEGSGILLFIFHANFLGKEVIARLCGP CSVQAVVLNDKFQLPVFLDSHFVYSFSPVAGPNKLFIRLTEAPSAKVKLL IGAYRVQLQ
    • Amino acids

      1 to 259
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162825 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HSMPP8
    • M-phase phosphoprotein 8
    • M-phase phosphoprotein, mpp
    • M-phase phosphoprotein, mpp8
    • MPHOSPH8
    • MPP8_HUMAN
    • RP11-523H24.1
    • Twa3
    • Two hybrid-associated protein 3 with RanBPM
    see all
  • Sequence similarities

    Contains 4 ANK repeats.
    Contains 1 chromo domain.
  • Post-translational
    modifications

    Phosphorylated in M (mitotic) phase.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab162825 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162825 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162825.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up