Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      IQNSTLGEAEIERERGVILREMQEVETNLQEVVFDYLHATAYQNTALGRT ILGPTENIKSISRKDLVDYITTHYKGPRIVLAAAGGVSHDELLDLAKFHF GDSLCTHKG
    • Amino acids
      161 to 269
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160524 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as PMPCB. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Beta MPP
    • Beta-MPP
    • BetaMPP
    • Mitochondrial processing peptidase subunit beta
    • Mitochondrial-processing peptidase subunit beta
    • MPP11
    • MPPB
    • MPPB_HUMAN
    • MPPP52
    • P 52
    • P-52
    • P52
    • Peptidase mitichondrial processing beta
    • PMPCB
    see all
  • Function
    Cleaves presequences (transit peptides) from mitochondrial protein precursors.
  • Sequence similarities
    Belongs to the peptidase M16 family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Images

  • ab160524 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160524 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160524.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up