Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKN LEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRK KRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLP AKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLY KFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLA LLLGYLHDFL KYLAKNSASLFTASDYKVASAEYHRKALLEHHHHHH
    • Molecular weight
      33 kDa including tags
    • Amino acids
      1 to 288
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172166 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 99% PBS, 0.88% Sodium chloride

General Info

  • Alternative names
    • KIAA0026
    • MO4L2_HUMAN
    • MORF related gene X protein
    • MORF-related gene X protein
    • Morf4l2
    • MORFL2
    • Mortality Factor 4 like 2
    • Mortality factor 4 like protein 2
    • Mortality factor 4-like protein 2
    • MRGX
    • MSL3 2 protein
    • Protein MSL3-2
    • Transcription factor like protein MRGX
    • Transcription factor-like protein MRGX
    see all
  • Function
    Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the MSIN3A complex which acts to repress transcription by deacetylation of nucleosomal histones.
  • Sequence similarities
    Belongs to the MRG family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE gel of ab172166 under non reduced (lane 1) and reduced (lane 2) conditions.

References

ab172166 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172166.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up