Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEF LRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLS
    • Molecular weight
      37 kDa including tags
    • Amino acids
      816 to 915

Specifications

Our Abpromise guarantee covers the use of ab152539 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ABC 29
    • ABC29
    • ABCC
    • ABCC 1
    • Abcc1
    • ATP binding cassette sub family C (CFTR/MRP) member 1
    • ATP binding cassette sub-family C member 1
    • ATP binding cassette subfamily C member 1
    • ATP binding cassette transporter variant ABCC1delta ex13
    • ATP binding cassette transporter variant ABCC1delta ex13&14
    • ATP binding cassette transporter variant ABCC1delta ex25
    • ATP binding cassette transporter variant ABCC1delta ex25&26
    • ATP binding cassette, sub-family C (CFTR/MRP), member 1
    • ATP-binding cassette sub-family C member 1
    • DKFZp686N04233
    • DKFZp781G125
    • GS X
    • GSX
    • Leukotriene C(4) transporter
    • LTC4 transporter
    • MRP
    • MRP 1
    • MRP1
    • MRP1_HUMAN
    • Multidrug resistance associated protein 1
    • Multidrug resistance protein
    • Multidrug resistance-associated protein 1
    • Multiple drug resistance associated protein
    • Multiple drug resistance protein 1
    see all
  • Function
    Mediates export of organic anions and drugs from the cytoplasm. Mediates ATP-dependent transport of glutathione and glutathione conjugates, leukotriene C4, estradiol-17-beta-o-glucuronide, methotrexate, antiviral drugs and other xenobiotics. Confers resistance to anticancer drugs. Hydrolyzes ATP with low efficiency.
  • Tissue specificity
    Lung, testis and peripheral blood mononuclear cells.
  • Sequence similarities
    Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.
    Contains 2 ABC transmembrane type-1 domains.
    Contains 2 ABC transporter domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152539 stained with Coomassie Blue.

References

ab152539 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152539.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up