Description

  • Product name

    Recombinant Human MRP1 protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      VRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRN YCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESA EGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDE EVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCLARALLRK TKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRV IVLDKGEIQEYGAPSDLLQQRGLFYSMAKDAGLV
    • Predicted molecular weight

      36 kDa including tags
    • Amino acids

      1248 to 1531
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab235016 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • ABC 29
    • ABC29
    • ABCC
    • ABCC 1
    • Abcc1
    • ATP binding cassette sub family C (CFTR/MRP) member 1
    • ATP binding cassette sub-family C member 1
    • ATP binding cassette subfamily C member 1
    • ATP binding cassette transporter variant ABCC1delta ex13
    • ATP binding cassette transporter variant ABCC1delta ex13&14
    • ATP binding cassette transporter variant ABCC1delta ex25
    • ATP binding cassette transporter variant ABCC1delta ex25&26
    • ATP binding cassette, sub-family C (CFTR/MRP), member 1
    • ATP-binding cassette sub-family C member 1
    • DKFZp686N04233
    • DKFZp781G125
    • GS X
    • GSX
    • Leukotriene C(4) transporter
    • LTC4 transporter
    • MRP
    • MRP 1
    • MRP1
    • MRP1_HUMAN
    • Multidrug resistance associated protein 1
    • Multidrug resistance protein
    • Multidrug resistance-associated protein 1
    • Multiple drug resistance associated protein
    • Multiple drug resistance protein 1
    see all
  • Function

    Mediates export of organic anions and drugs from the cytoplasm. Mediates ATP-dependent transport of glutathione and glutathione conjugates, leukotriene C4, estradiol-17-beta-o-glucuronide, methotrexate, antiviral drugs and other xenobiotics. Confers resistance to anticancer drugs. Hydrolyzes ATP with low efficiency.
  • Tissue specificity

    Lung, testis and peripheral blood mononuclear cells.
  • Sequence similarities

    Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.
    Contains 2 ABC transmembrane type-1 domains.
    Contains 2 ABC transporter domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab235016.

References

ab235016 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235016.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up