Description

  • Product name

    Recombinant Human MRP2 protein
  • Biological activity

    useful for Antibody Production and Protein Array
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEK SSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSGTKKDVPKSWLMKA
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      214 to 313
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112272 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Best use within three months from the date of receipt of this protein.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names

    • ABC30
    • abcC2
    • ATP binding cassette sub family C (CFTR/MRP) member 2
    • ATP binding cassette subfamily C member 2
    • ATP-binding cassette sub-family C member 2
    • Canalicular multidrug resistance protein
    • Canalicular multispecific organic anion transporter 1
    • CMOAT
    • CMOAT1
    • cMRP
    • DJS
    • KIAA1010
    • MRP 2
    • MRP2_HUMAN
    • Multidrug resistance associated protein 2
    • Multidrug resistance-associated protein 2
    see all
  • Function

    Mediates hepatobiliary excretion of numerous organic anions. May function as a cellular cisplatin transporter.
  • Tissue specificity

    Found on the apical membrane of polarized cells in liver, kidney and intestine. The highest expression is found in liver.
  • Involvement in disease

    Defects in ABCC2 are the cause of Dubin-Johnson syndrome (DJS) [MIM:237500]. DJS is an autosomal recessive disorder characterized by conjugated hyperbilirubinemia, an increase in the urinary excretion of coproporphyrin isomer I, deposition of melanin-like pigment in hepatocytes, and prolonged retention of sulfobromophthalein, but otherwise normal liver function.
  • Sequence similarities

    Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.
    Contains 2 ABC transmembrane type-1 domains.
    Contains 2 ABC transporter domains.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References

ab112272 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112272.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up