Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLPVYQEVKPNPLQDANLCSRVFFWWLNPLFKIGHKRRLEEDDMYSVLPE DRSQHLGEELQGFWDKEVLRAENDAQKPSLTRAIIKCYWKSYLVLGIFTL IEESAKVIQP
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160907 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ABCC 4
    • ABCC4
    • ATP binding cassette sub family C (CFTR/MRP) member 4
    • ATP binding cassette sub family C member 4
    • ATP-binding cassette sub-family C member 4
    • bA464I2.1
    • bA464I2.1 (ATP binding cassette, sub-family C (CFTR/MRP) member 4)
    • Canalicular multispecific organic anion transporter
    • Canalicular multispecific organic anion transporter ABC superfamily
    • EST170205
    • MOAT B
    • MOAT-B
    • MOATB
    • MRP 4
    • MRP/cMOAT related ABC transporter
    • MRP/cMOAT-related ABC transporter
    • MRP4_HUMAN
    • Multi specific organic anion transporter B
    • Multi-specific organic anion transporter B
    • Multidrug resistance associated protein 4
    • Multidrug resistance-associated protein 4
    • OTTHUMP00000018560
    see all
  • Function
    May be an organic anion pump relevant to cellular detoxification.
  • Tissue specificity
    Widely expressed, with particularly high levels in prostate, but is barely detectable in liver.
  • Sequence similarities
    Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.
    Contains 2 ABC transmembrane type-1 domains.
    Contains 2 ABC transporter domains.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab160907 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160907 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160907.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up