Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTRKRTYWVPNSSGGLVNRGIDIGDDMVSGLIYKTYTLQDGPWSQQERNP EAPGRAAVPPWGKYDAALRTMIPFRPKPRFPAPQPLDNAGLFSYLTVSWL TPLMIQSLRSRLDENTIPPLSVHDASDKNVQRLHRLWEEEVSRRGIEKAS VLLVMLRFQRTRLIFDALLGICFCIASVLGPILIIPKILEYSEEQLGNVV HGVGLCFALFLSECVKSLSFSSSWIINQRTAIRFRAAVSSFAFEKLIQFK SVIHITSGEAISFFTGDVNYLFEGVCYGPLVLITCASLVICSISSYFIIG YTAFIAILCYLLVFPLAVFMTRMAVKAQHHTSEVSDQRIRVTSEVLTCIK LIKMYTWEKPFAKIIEDLRRKERKLLEKCGLVQSLTSITLFIIPTVATAV WVLIHTSLKLKLTASMAFSMLASLNLLRLSVFFVPIAVKGLTNSKSAVMR FKKFFLQESPVFYVQTLQDPSKALVFEEATLSWQQTCPGIVNGALELERN GHASEGMTRPRDALGPEEEGNSLGPELHKINLVVSKVALFRPRRQASCQA LRT
    • Amino acids
      1 to 553
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164740 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as ABCC11

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ABCC 11
    • ABCC11
    • ABCCB_HUMAN
    • ATP binding cassette protein C11
    • ATP binding cassette sub family C (CFTR/MRP) member 11
    • ATP binding cassette sub family C member 11
    • ATP binding cassette transporter MRP8
    • ATP binding cassette transporter sub family C member 11
    • ATP-binding cassette sub-family C member 11
    • EWWD
    • MRP8
    • Multi resistance protein 8
    • Multidrug resistance associated protein 8
    • Multidrug resistance-associated protein 8
    • OTTHUMP00000164191
    • WW
    see all
  • Function
    Participates in physiological processes involving bile acids, conjugated steroids and cyclic nucleotides. Enhances the cellular extrusion of cAMP and cGMP. Stimulates the ATP-dependent uptake of a range of physiological and synthetic lipophilic anions, including the glutathione S-conjugates leukotriene C4 and dinitrophenyl S-glutathione, steroid sulfates such as dehydroepiandrosterone 3-sulfate (DHEAS) and estrone 3-sulfate, glucuronides such as estradiol 17-beta-D-glucuronide (E(2)17betaG), the monoanionic bile acids glycocholate and taurocholate, and methotrexate. Probably functions to secrete earwax.
  • Tissue specificity
    Expressed in many tissues. Not expressed in kidney, spleen and colon. Highly expressed in breast cancer. Expressed at moderate levels in normal breast and testis and at very low levels in liver, brain and placenta.
  • Sequence similarities
    Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily.
    Contains 2 ABC transmembrane type-1 domains.
    Contains 2 ABC transporter domains.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab164740 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164740 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164740.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up