Description

  • Product name

    Recombinant Human MRPL20 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MVFLTAQLWLRNRVTDRYFRIQEVLKHARHFRGRKNRCYRLAVRTVIRAF VKCTKARYLKKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRK VLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH
    • Amino acids

      1 to 149
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162945 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 39S ribosomal protein L20, mitochondrial
    • L20mt
    • MGC4779
    • MGC74465
    • Mitochondrial ribosomal protein L20
    • MRPL 20
    see all
  • Relevance

    MRPL20 is one of more than 70 protein components of mitochondrial ribosomes that are encoded by the nuclear genome. MRPL20 is a subunit of the 39S mitochondrial ribosome. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology.
  • Cellular localization

    Mitochondrial

Images

  • ab162945 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162945 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162945.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up