Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSSGEKPIYSVGGILLSISRPYKTKPTHG IGKYKHLIKAEEPKKKKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAES YAQYVHNLCNSLSIKVEESYAMPTKTIEVLQLQDQGSKMLLDSVLTTHER VVQISGLSATFAEIFLEIIQSSLPEGVRLSVKEHTEEDFKGRFKARPELE ELLAKLK
    • Molecular weight

      23 kDa including tags
    • Amino acids

      29 to 212
    • Tags

      His tag N-Terminus
    • Additional sequence information

      (NCBI Accession No.: NP_057139)

Specifications

Our Abpromise guarantee covers the use of ab187432 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • 39S ribosomal protein L48
    • 39S ribosomal protein L48 mitochondrial
    • CGI 118
    • CGI-118
    • FLJ17047
    • FLJ99260
    • HSPC290
    • L48mt
    • MGC13323
    • mitochondrial
    • Mitochondrial ribosomal protein L48
    • MRP L48
    • MRP-L48
    • MRPL48
    • RM48_HUMAN
    see all
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab187432.

References

ab187432 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187432.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up