Description

  • Product name

    Recombinant Human MRPS16 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQ LGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLH PMMITNAERLRRKRAREVLLASQKTDAEATDTEATET
    • Amino acids

      1 to 137
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162396 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 28S ribosomal protein S16
    • 28S ribosomal protein S16 mitochondrial
    • CGI-132
    • COXPD2
    • mitochondrial
    • Mitochondrial ribosomal protein S16
    • MRP-S16
    • mrps16
    • RPMS16
    • RT16_HUMAN
    • S16mt
    see all
  • Involvement in disease

    Defects in MRPS16 are the cause of combined oxidative phosphorylation deficiency type 2 (COXPD2) [MIM:610498]. Defects in the mitochondrial oxidative phosphorylation system result in devastating, mainly multisystem, diseases. COXPD2 symptoms include fatal neonatal metabolic acidosis with agenesis of the corpus callosum.
  • Sequence similarities

    Belongs to the ribosomal protein S16P family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • ab162396 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162396 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162396.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up