Description

  • Product name

    Recombinant Human MRPS18B protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISP YKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKV VGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRL TQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSSDPWY PWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTG QTGPQSAL
    • Amino acids

      1 to 258
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162191 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 28S ribosomal protein S18-2
    • 28S ribosomal protein S18b
    • 28S ribosomal protein S18b, mitochondrial
    • C6orf14
    • DKFZp564H0223
    • HSPC 183
    • HSPC183
    • mitochondrial
    • Mitochondrial ribosomal protein S18 2
    • Mitochondrial ribosomal protein S18B
    • MRP S18 2
    • MRP S18 b
    • MRP S18b
    • MRP-S18-2
    • MRP-S18-b
    • MRPS 18B
    • MRPS18 2
    • Mrps18-b
    • MRPS18B
    • PTD017
    • RT18B_HUMAN
    • S18amt
    • S18mt-b
    see all
  • Sequence similarities

    Belongs to the ribosomal protein S18P family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • ab162191 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162191 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162191.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up