Recombinant Human MRPS21 protein (ab162746)
- Datasheet
- References
- Protocols
Overview
-
Product nameRecombinant Human MRPS21 protein
-
Protein lengthFull length protein
Description
-
NatureRecombinant
-
SourceWheat germ
-
Amino Acid Sequence
-
SpeciesHuman
-
SequenceMAKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCR RRQRESYERCRRIYNMEMARKINFLMRKNRADPWQGC
-
Amino acids1 to 87
-
Tagsproprietary tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab162746 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
ELISA
-
FormLiquid
-
Additional notesProtein concentration is above or equal to 0.05 mg/ml.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- MDS016
- mitochondrial 28S ribosomal protein S21
- Mitochondrial ribosomal protein S21
see all -
RelevanceMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S21P family. Pseudogenes corresponding to this gene are found on chromosomes 1p, 1q, 9p, 10p, 10q, 16q, and 17q. Available sequence data analyses identified splice variants that differ in the 5' UTR; both transcripts encode the same protein. [provided by RefSeq]
-
Cellular localizationMitochondrial small ribosomal subunit
Images
Datasheets and documents
References
ab162746 has not yet been referenced specifically in any publications.