Description

  • Product name

    Recombinant Human MRS2/HPT protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MECLRSLPCLLPRAMRLPRRTLCALALDVTSVGPPVAACGRRANLIGRSR AAQLCGPDRLRVAGEVHRFRTSDVSQATLASVAPVFTVTKFDKQGNVTSF VFESCDNSRVSSDIRLS
    • Amino acids

      1 to 117
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163541 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as MRS2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Gm902
    • HPT
    • Magnesium transporter MRS2 homolog, mitochondrial
    • MGC78523
    • MRS2 like protein
    • MRS2 like, magnesium homeostasis factor
    • MRS2 like, magnesium homeostasis factor (S. cerevisiae)
    • MRS2 magnesium homeostasis factor homolog (S. cerevisiae)
    • MRS2L
    • RPT
    see all
  • Relevance

    MRS2 is a magnesium transporter that may mediate the influx of magnesium into the mitochondrial matrix. There are 3 isoforms produced by alternative splicing.
  • Cellular localization

    Mitochondrion inner membrane; Multi-pass membrane protein (by similarity).

Images

  • ab163541 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163541 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163541.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up