Overview

  • Product name
    Recombinant Human MS4A5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDSSTAHSPVFLVFPPEITASEYESTELSATTFSTQSPLQKLFARKMKIL GTIQILFGIMTFSFGVIFLFTLLKPYPRFPFIFLSGYPFWGSVLFINSGA FLIAVKRKTTETLIILSRIMNFLSALGAIAGIILLTFGFILDQNYICGYS HQNSQCKAVTVLFLGILITLMTFSIIELFISLPFSILGCHSEDCDCEQCC
    • Amino acids
      1 to 200
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163811 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD20 antigen like 2
    • CD20 L2
    • CD20L2
    • Membrane spanning 4 domains subfamily A member 5
    • Testis expressed transmembrane 4 protein
    • Testis expressed transmembrane protein 4
    • TETM4
    see all
  • Relevance
    MS4A5 is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. Though this member is not expressed in hematopoietic cells specifically, it may be involved in signal transduction like many of its related family members. The gene encoding this protein is localized to 11q12, among a cluster of family members
  • Cellular localization
    Membrane; Multi-pass membrane protein.

Images

  • ab163811 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163811 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163811.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up