Description

  • Product name

    Recombinant Human MS4A8B protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNP PSLVSNVNGQPVQKALKEGKTLGAIQIIIGLARIGLGSIMATVLVGEYLS ISFYGGFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLGLNIVSAICSA VGVILFITDLSIPHPYAYPDYYPYAWGVNPGMAISGVLLVFCLLEFGIAC ASSHFGCQLVCCQSSNVSVIYPNIYAANPVITPEPVTSPPSYSSEIQANK
    • Amino acids

      1 to 250
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164420 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 4SPAN4
    • CD20L5
    • Four span transmembrane protein 4
    • Four-span transmembrane protein 4
    • M4A8_HUMAN
    • membrane spanning 4 domains subfamily A member 8
    • Membrane spanning 4 domains subfamily A member 8B
    • Membrane-spanning 4-domains subfamily A member 8
    • Membrane-spanning 4-domains subfamily A member 8B
    • MS4A4
    • Ms4a8
    • MS4A8B
    see all
  • Function

    May be involved in signal transduction as a component of a multimeric receptor complex.
  • Tissue specificity

    Expressed by hematopoietic tissues and cells lines.
  • Sequence similarities

    Belongs to the MS4A family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab164420 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164420 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164420.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up