Description

  • Product name

    Recombinant Human MSC protein
    See all MSC proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSTGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNSSAEEE DPDGEEERCALGTAGSAEGCKRKRPRVAGGGGAGGSAGGGGKKPLPAKGS AAECKQSQRNAANARERARMRVLSKAFSRLKTSLPWVPPDTKLSKLDTLR LASSYIAHLRQLLQEDRYENGYVHPVNLTWPFVVSGRPDSDTKEVSAANR LCGTTA
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      1 to 206

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131820 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ABF-1
    • ABF1
    • Activated B cell factor 1
    • Activated B-cell factor 1
    • bHLHa22
    • Class A basic helix-loop-helix protein 22
    • Msc
    • MUSC_HUMAN
    • Musculin
    • MYOR
    see all
  • Function

    Transcription repressor capable of inhibiting the transactivation capability of TCF3/E47. May play a role in regulating antigen-dependent B-cell differentiation.
  • Tissue specificity

    Expressed in lymphoid tissues, B-cell lines and activated B-cells.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab131820 at approximately 48.5 kDa.

References

ab131820 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131820.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up